Caballeronia sp. SBC2: SBC2_25930 Help Entry SBC2_25930        CDS       T06459                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism caba  Caballeronia sp. SBC2 Pathway caba00998   Biosynthesis of various antibiotics caba01100   Metabolic pathways caba01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:caba00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SBC2_25930 (acpP_2)    00074 Mycolic acid biosynthesis     SBC2_25930 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SBC2_25930 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  QIE24546 LinkDB All DBs Position complement(2861593..2861832) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacagcgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcttcgttcgtcaacgatctgggcgctgactcgctcgacacc gtcgaactcgtgatggctctcgaagacgaattcggcatggaaatccctgacgaagaagct gagaagatcacgacggttcagcaagcgatcgactacgctcgcgctaacgtcaaggcctaa

DBGET integrated database retrieval system