Caballeronia sp. SBC2: SBC2_78090 Help Entry SBC2_78090        CDS       T06459                                  Symbol acpP_3 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism caba  Caballeronia sp. SBC2 Pathway caba00998   Biosynthesis of various antibiotics caba01100   Metabolic pathways caba01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:caba00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SBC2_78090 (acpP_3)    00074 Mycolic acid biosynthesis     SBC2_78090 (acpP_3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SBC2_78090 (acpP_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIE29733 LinkDB All DBs Position pSBC2-3:703073..703360 Genome browser AA seq 95 aa AA seqDB search MTTTFEWLRTTLAQDYNLEPAALTPDASLETLGLDSLAVAELLFAVEEKFKITVMAEPPP LKTLKDVYQFIDAQIAVQHGDLTAKNELPSSSSAV NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaccaccacatttgaatggcttcgcacaacgctagctcaggactacaatctcgagccg gcggcgctgacccctgatgcttcactcgaaacgcttggccttgactcactggcggtggcc gaattgctgttcgccgttgaagaaaaattcaagataaccgtgatggcagaaccgccgcct ctaaaaactctaaaggatgtctatcagtttatcgatgcgcagattgcggttcagcacgga gacttgaccgcgaaaaacgagttgccctcgtcatcttcagcggtatga

DBGET integrated database retrieval system