Caballeronia sp. SBC2: SBC2_78760 Help Entry SBC2_78760        CDS       T06459                                  Name (GenBank) DNA-binding protein Bv3F   KO K03746   DNA-binding protein H-NS Organism caba  Caballeronia sp. SBC2 Brite KEGG Orthology (KO) [BR:caba00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:caba03036]     SBC2_78760    03400 DNA repair and recombination proteins [BR:caba03400]     SBC2_78760 Chromosome and associated proteins [BR:caba03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     SBC2_78760 DNA repair and recombination proteins [BR:caba03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       SBC2_78760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Motif Other DBs NCBI-ProteinID:  QIE29800 LinkDB All DBs Position pSBC2-3:774881..775177 Genome browser AA seq 98 aa AA seqDB search MSLGYRELLAQREALEKQIAEVGALEREGVIDELKEKMALFGITPADLGKRDGRKQRKHT GPVAAKYRDPQSGATWSGRGRAPLWLADQDREKFVIAD NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgagtctgggatatcgcgagctgctcgcacaacgtgaagcgctagaaaaacaaatcgcc gaagtcggcgcgctggagcgcgaaggcgtgatcgacgagttgaaggaaaagatggcgctc ttcggcatcaccccggccgacttgggcaaacgcgatggccgcaaacagcgcaaacacacg ggaccggtcgctgcgaaataccgggacccgcagtcgggcgcgacctggagcggccgcggt cgcgcgccgctttggttggcggaccaggaccgcgagaaattcgtgatcgccgattga

DBGET integrated database retrieval system