KEGG   Chelonoidis abingdonii (Abingdon island giant tortoise): 116821902
Entry
116821902         CDS       T07367                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
cabi  Chelonoidis abingdonii (Abingdon island giant tortoise)
Pathway
cabi04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cabi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    116821902 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cabi04050]
    116821902 (TNFRSF8)
   04090 CD molecules [BR:cabi04090]
    116821902 (TNFRSF8)
Cytokine receptors [BR:cabi04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   116821902 (TNFRSF8)
CD molecules [BR:cabi04090]
 Proteins
  116821902 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 KIAA1328
Other DBs
NCBI-GeneID: 116821902
NCBI-ProteinID: XP_032631280
LinkDB
Position
Unknown
AA seq 520 aa
MAARGRRRLLLLLLLLQGTQAAPPQTLITSPQSCNVLENRVYDETSQRCCYQCPSGYHKR
KECPTDPDRDCGQCEPEHFLNREQGKPHCELCVSCKPEYNLVEKVPCSFNSRRVCECQAG
LFCKVAVVNSCVQCISHTVCKPGFGVLARGTSEVDVTCQECPSGTFSDRHSSTERCKPHT
DCAKLNKVAVDSGNSTHDQVCMDPPPTHLTPASLSAKFSNRPKDSDRAEVPLLNDQPMTV
TGQHSHTATKPVTSASILMSDAASDDANWTTSEAVGGSDTKYAAGTSPTSDIATEETAKT
GDGSFVPWGAVVLCSMVLLAGMLVVWQRKVCKRRIFTPNGKTLDLYPVTTCRPKSSSQGS
DLMKNCAKRFSMLKADKESEERELLNRTPIVETNNNLVSISEKNPSPDSSLTEVIQSTGN
ATDYPADSRVRDHTNNRIDKIYIMKADTVIVGSISEVPVSKNCAVRGCENDAKVQENMEE
NELAMHYPQQETESFPGSDVMIPVEEEGKEFHHPTTATEK
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggctgcccgggggcggcggcggctgctcctgctgctcctgcttctccaggggacccag
gcggcgcccccgcagacattgattacctcacctcagtcctgtaatgtgctagagaacagg
gtctatgatgaaacttcccaacgctgctgctaccaatgtccctcaggctaccataaacgg
aaagagtgtcccacagatccagaccgggactgtgggcagtgtgagcccgagcacttcctg
aacagggagcaagggaagccacactgcgagctctgtgtgtcgtgcaagccagaatacaac
cttgtggaaaaagtcccttgctccttcaattccagaagggtgtgtgagtgccaagcagga
ctgttttgtaaagttgctgttgtgaacagctgtgtgcaatgcatttcccacactgtctgc
aagccaggatttggagtcctagccagaggcacgtcagaagttgatgtcacttgccaagaa
tgcccttcggggaccttctctgatcggcactccagcaccgaacgctgcaaaccccacaca
gactgcgccaagctaaacaaagtagctgtggacagcggaaattccacacacgaccaagtc
tgcatggacccgcctcctacccacctcacacccgcctctttgtctgcaaaattcagcaac
aggccgaaggattccgacagggcagaagtgccgctcctgaatgatcagccaatgaccgtg
acaggccagcattcccacactgccacaaagccagtgaccagcgccagcatcctcatgagt
gacgcagcctctgacgatgccaactggaccacttcggaagctgtcggtggatcggataca
aaatacgcagctggcacttctcctacctcggatatagctacagaagagactgccaagaca
ggtgatgggagctttgttccctggggtgcggtggttctctgcagcatggtgcttctcgct
ggtatgctggtggtttggcaaaggaaggtttgcaagaggcgaattttcacccccaatggg
aagactcttgatctgtatccagtcactacatgtagacccaaatcttcaagtcaaggttct
gatctgatgaagaactgtgcaaagaggttcagtatgctgaaagctgacaaagagtcagaa
gagagggagttgttgaacagaactcccattgtggaaaccaacaacaacttggtctccatc
tcagaaaaaaatcccagtcctgactcaagcctgacagaggtgatccagagcactgggaat
gccaccgactaccctgctgattcccgagtgagggaccacacgaataaccgaattgacaaa
atatacataatgaaagccgacactgtgattgtggggtccatttcggaagtgcccgtcagc
aagaactgcgccgttagaggatgtgaaaatgatgctaaggttcaagaaaacatggaggaa
aacgaacttgcaatgcattatccacagcaggagacagaatcatttccaggaagtgatgta
atgattccggtggaggaggagggcaaggaatttcatcaccctaccactgccactgagaaa
tga

DBGET integrated database retrieval system