Caballeronia sp. NK8: NK8_28710 Help Entry NK8_28710         CDS       T09553                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism cabk  Caballeronia sp. NK8 Brite KEGG Orthology (KO) [BR:cabk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cabk03036]     NK8_28710    03400 DNA repair and recombination proteins [BR:cabk03400]     NK8_28710 Chromosome and associated proteins [BR:cabk03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     NK8_28710 DNA repair and recombination proteins [BR:cabk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       NK8_28710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N DUF7307 Motif Other DBs NCBI-ProteinID:  BCQ24696 LinkDB All DBs Position 1:3007924..3008226 Genome browser AA seq 100 aa AA seqDB search MPSYKELLAQRESLERQIEEAKSREYAEVLNEIKQKMADYGITLAELAGGRGAKGAKAAR SRSGVAPKYRDPDSGSTWSGRGKPPKWIAGQDRDSFLIGK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttcatacaaagaacttctcgcacaacgcgagtcccttgagcgccagattgaagaa gcgaagtcgcgcgaatacgccgaagtgcttaatgagatcaagcagaaaatggcggattac ggcatcacgcttgcggaactggctggcggccgtggcgcgaaaggcgcgaaggcggcacgc agccgctcgggcgtggcgccgaaataccgtgacccggacagcggcagcacttggtcgggc cgcggaaagccgccgaagtggatcgctgggcaggatcgcgacagtttcctgatcggcaag taa

DBGET integrated database retrieval system