Caballeronia sp. NK8: NK8_49970 Help Entry NK8_49970         CDS       T09553                                  Name (GenBank) phenol hydroxylase   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism cabk  Caballeronia sp. NK8 Pathway cabk00361   Chlorocyclohexane and chlorobenzene degradation cabk00362   Benzoate degradation cabk00623   Toluene degradation cabk01100   Metabolic pathways cabk01120   Microbial metabolism in diverse environments cabk01220   Degradation of aromatic compounds Module cabk_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:cabk00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     NK8_49970    00361 Chlorocyclohexane and chlorobenzene degradation     NK8_49970    00623 Toluene degradation     NK8_49970 Enzymes [BR:cabk01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      NK8_49970     1.14.13.244  phenol 2-monooxygenase (NADH)      NK8_49970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  BCQ26813 LinkDB All DBs Position 3:747029..747391 Genome browser AA seq 120 aa AA seqDB search MSVIALKKGYRGEIRDRVENYRGKQLLFVGWEDHLMFCAPHCIPVEAATPFRALVDEMLP AMYASHPDWCKADLRAAEWFRSGQPFTPDFDATIGENGLGHKAVIRFRTPGLNGIGGSCS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtcagtcatcgcgctgaagaaaggctatagaggcgagatcagggatcgcgtcgagaac tatcgcggcaagcagttgctcttcgtcggctgggaggatcatctgatgttctgcgcgccg cattgcattccagtcgaagcggccacgccgttccgggcactcgtcgacgagatgctgccg gcgatgtatgcctcgcatccggactggtgcaaggccgatttgcgcgccgccgaatggttc aggtcgggccagccgttcacgcccgatttcgatgcgaccatcggcgagaacggtctcggc cacaaggcggtcattcgtttccgcacgccgggattgaacggcatcggcggatcgtgcagc tag

DBGET integrated database retrieval system