Caballeronia sp. NK8: NK8_56510 Help Entry NK8_56510         CDS       T09553                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cabk  Caballeronia sp. NK8 Pathway cabk00998   Biosynthesis of various antibiotics cabk01100   Metabolic pathways cabk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cabk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NK8_56510    00074 Mycolic acid biosynthesis     NK8_56510   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NK8_56510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BCQ27462 LinkDB All DBs Position pNK81:619936..620196 Genome browser AA seq 86 aa AA seqDB search MNELERELAELIVTELNLEDVDPKAVSADTRLYEEGFGLDSIDILEIALLISKKYGFELR SDNPDNQKIFANLGALAAHVAAHRTR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgaactggaaagagagctcgcggagctgatcgtcaccgaattgaacctcgaggac gtcgatcccaaggccgtctcggccgacacgcggttgtatgaagaaggattcgggctcgat tccatcgacatcctggagatcgcgcttctgatctcgaagaaatacggcttcgagctgcgc tcggacaatccggacaatcagaagatcttcgcgaacctcggcgcgctcgcggcgcacgtc gccgcgcaccgcacgcgttaa

DBGET integrated database retrieval system