Caballeronia sp. NK8: NK8_69260 Help Entry NK8_69260         CDS       T09553                                  Name (GenBank) hypothetical protein   KO K03741   arsenate reductase (thioredoxin) [EC:1.20.4.4] Organism cabk  Caballeronia sp. NK8 Brite KEGG Orthology (KO) [BR:cabk00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     NK8_69260 Enzymes [BR:cabk01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.4  arsenate reductase (thioredoxin)      NK8_69260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LMWPc Motif Other DBs NCBI-ProteinID:  BCQ28736 LinkDB All DBs Position pNK82:393608..393919 Genome browser AA seq 103 aa AA seqDB search MTTNVSILCTHNSARSVLGDATLNHYCDSAAAEACAFWPGSPVRVHRGDADGSNAPGGDD VKRQAFELTRQAIGYRMLQLLELPLDRLGDAELQQALNDILQS NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgacaaccaacgtatcgatcctgtgcacgcacaactcggcgcgcagcgtgctcggcgat gccacgctgaatcactactgcgacagcgccgccgccgaagcatgtgcgttctggccgggt agtccggtcagggtgcatcggggcgatgccgacgggtcgaacgcaccgggcggcgatgac gtcaagcgtcaggcgttcgagctgacccgccaggcgatcggctatcgcatgctgcagttg cttgaacttcccctggaccgtctgggcgatgccgagcttcagcaggcgctcaatgacatc ctgcaaagctga

DBGET integrated database retrieval system