Clostridium aceticum: CACET_c02330 Help Entry CACET_c02330      CDS       T03971                                  Symbol flgJ Name (GenBank) flagellar protein FlgJ   KO K02395   peptidoglycan hydrolase FlgJ Organism cace  Clostridium aceticum Pathway cace02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:cace00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     CACET_c02330 (flgJ)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:cace02035]     CACET_c02330 (flgJ) Bacterial motility proteins [BR:cace02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     CACET_c02330 (flgJ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding CsgF Motif Other DBs NCBI-ProteinID:  AKL93749 UniProt:  A0A0D8I6X5 LinkDB All DBs Position 246432..246743 Genome browser AA seq 103 aa AA seqDB search MKVNDHMLQFASAQKIQNKNLTEDPEKLMEACKEFEAIFLNMMLQQMRKTITEDGFVEKS YGREIYESMQDEEISKEMARGQGIGLAKQLYQQLSRNIKTSAE NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaaggttaatgatcacatgctgcaatttgccagcgctcaaaaaattcaaaacaaaaat cttacggaagacccagaaaaactgatggaggcatgtaaggagtttgaagctatcttccta aatatgatgctgcaacagatgagaaaaacaattactgaggatggttttgtagagaaaagc tatggacgagagatttatgaaagcatgcaggatgaagaaatttcaaaggagatggctaga ggccagggtattggacttgcaaaacaactctatcaacaactatctagaaatataaaaact tctgctgagtag

DBGET integrated database retrieval system