Cognatishimia activa: HZ995_06025 Help Entry HZ995_06025       CDS       T07138                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism cact  Cognatishimia activa Brite KEGG Orthology (KO) [BR:cact00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cact03110]     HZ995_06025 (grxC) Chaperones and folding catalysts [BR:cact03110]  Protein folding catalysts   Protein disulfide isomerase    HZ995_06025 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 SH3BGR Motif Other DBs NCBI-ProteinID:  QTN37063 UniProt:  A0A975I8A1 LinkDB All DBs Position complement(1247548..1247802) Genome browser AA seq 84 aa AA seqDB search MKNVEIYTRPLCGFCSAAKSLLDRKSVAYVEVKVWDNPERKPEMIQRSGGRSTFPQIFID GEHIGGCDDLMALEHSGKLDRMLA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaaaaacgttgagatatatacgcgcccgctttgcgggttctgttccgccgccaagtct ttgttggaccgtaaatcagtggcttatgtcgaggtgaaagtctgggacaaccctgaacgc aaacccgagatgatacagcgctcgggtggccgcagcacctttccgcagatctttatcgac ggcgaacatatcggcggatgcgacgatctgatggcgcttgagcacagcggcaagttggat cggatgctggcctaa

DBGET integrated database retrieval system