Cognatishimia activa: HZ995_14505 Help Entry HZ995_14505       CDS       T07138                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cact  Cognatishimia activa Pathway cact01100   Metabolic pathways cact01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cact00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HZ995_14505    00074 Mycolic acid biosynthesis     HZ995_14505   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HZ995_14505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QTN35668 UniProt:  A0A975I708 LinkDB All DBs Position complement(2932268..2932525) Genome browser AA seq 85 aa AA seqDB search MSVKDKVIEIIAEQAVLEVSDVTPDSTLEDLGIDSLGLVESIFAIEEAFDISVPFNANEP SESDFDISNVATIISGIEKLVSEQA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcgtcaaggacaaggtaatcgagatcatcgcagaacaagcggttctggaggtttcc gatgtcacgcctgacagcacgctagaggatctgggcatcgacagccttgggctggttgag agcatttttgccattgaagaggcctttgatatctcggtcccatttaatgcaaatgagcca agcgagagcgattttgatatttcaaacgtcgccactattatttctggtatcgaaaaactg gtgtcagaacaggcctag

DBGET integrated database retrieval system