Caenibius sp. WL: K5X80_11595 Help Entry K5X80_11595       CDS       T08345                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism caen  Caenibius sp. WL Pathway caen01100   Metabolic pathways caen01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:caen00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K5X80_11595    00074 Mycolic acid biosynthesis     K5X80_11595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K5X80_11595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  QZP07323 LinkDB All DBs Position complement(2439583..2439819) Genome browser AA seq 78 aa AA seqDB search MSDTADRVKKIVVEHLGVEADKVAPDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIGTVGDAIKYIDDNKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgctgaccgcgttaagaagattgtcgtcgaacaccttggcgtggaggcc gacaaggttgctcccgatgccagcttcatcgacgatctgggtgcagacagcctcgacatc gtcgaactggtgatggctttcgaagaagaattcggcgtcgaaatccccgacgatgcggcg gaaaagatcggcaccgttggcgacgcgatcaagtacatcgacgacaacaagggctga

DBGET integrated database retrieval system