Caenibius sp. WL: K5X80_11810 Help Entry K5X80_11810       CDS       T08345                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism caen  Caenibius sp. WL Brite KEGG Orthology (KO) [BR:caen00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:caen03032]     K5X80_11810    03036 Chromosome and associated proteins [BR:caen03036]     K5X80_11810    03400 DNA repair and recombination proteins [BR:caen03400]     K5X80_11810 DNA replication proteins [BR:caen03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     K5X80_11810 Chromosome and associated proteins [BR:caen03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     K5X80_11810 DNA repair and recombination proteins [BR:caen03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       K5X80_11810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 VWA_3 DUF2267 Motif Other DBs NCBI-ProteinID:  QZP07360 LinkDB All DBs Position complement(2477934..2478206) Genome browser AA seq 90 aa AA seqDB search MNKNDLISAVADSSGLSRSDATKAVEGVFDAITAALAKGDEVRLVGFGTFATAKRKASTG RNPRTGEAMTIKASTQPKFKAGKGLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaaacgatctgatcagcgctgttgcagattcgagcggcctttcccgcagtgac gcgaccaaggctgtcgaaggtgtgttcgatgcgatcaccgcagcgctggcaaagggcgac gaagtgcgcctcgtcggcttcggcacgttcgcgaccgccaagcgcaaggcttccaccggc cgtaacccgcgcaccggcgaagcgatgaccatcaaggcttccacgcagccgaagttcaag gctggcaagggcctgaaggacgcggtcaactaa

DBGET integrated database retrieval system