Collinsella aerofaciens: CSV91_05260
Help
Entry
CSV91_05260 CDS
T05143
Symbol
fabF
Name
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase II
KO
K09458
3-oxoacyl-[acyl-carrier-protein] synthase II [EC:
2.3.1.179
]
Organism
caer
Collinsella aerofaciens
Pathway
caer00061
Fatty acid biosynthesis
caer00780
Biotin metabolism
caer01100
Metabolic pathways
caer01212
Fatty acid metabolism
caer01240
Biosynthesis of cofactors
Module
caer_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
caer00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
CSV91_05260 (fabF)
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
CSV91_05260 (fabF)
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
caer01004
]
CSV91_05260 (fabF)
Enzymes [BR:
caer01000
]
2. Transferases
2.3 Acyltransferases
2.3.1 Transferring groups other than aminoacyl groups
2.3.1.179 beta-ketoacyl-[acyl-carrier-protein] synthase II
CSV91_05260 (fabF)
Lipid biosynthesis proteins [BR:
caer01004
]
Fatty acid synthase
Component type
CSV91_05260 (fabF)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ketoacyl-synt
Ketoacyl-synt_C
Thiolase_N
Motif
Other DBs
NCBI-ProteinID:
ATP53997
UniProt:
A0A2D1TXC3
LinkDB
All DBs
Position
complement(1192958..1194205)
Genome browser
AA seq
415 aa
AA seq
DB search
MEQRVAITGIGAVSPLGNTALATWAAMCAGTCGIGPITHFDTDAFTVKVAAEVKGFDGNE
YFGKRDAKHLDPCVQFAMAASDEAMHDAGFDVEGAIDRERLGVYVGSGVGGMQTLVDNVH
TIADRGPRRASPYMIAMMIPNMASGNIAIRHKAKGPTLPVVTACATSAHAVGEAFRAIKH
GYADAILAGGAEAAIIPDAVAGFTSCRALTTNPDPATACRPFDADRDGFVMGEGACVLVL
ESMEHAQARGAHIYAEVVGYGNTDDAYHITSPDPEAAGIARAISLAVAEGDVKPSEGLYI
NAHGTSTRLNDSSETAGIKRALGEDAARAAHVSSTKSMTGHMIGATGAIEVMACAMALEQ
GVVPPTINYHTPDPACDLDYTPNRAVRADLTWALSTNLGFGGHNAAIALRRYARS
NT seq
1248 nt
NT seq
+upstream
nt +downstream
nt
atggaacagagagttgcaatcaccggcatcggtgccgtatcgccgctcggcaacaccgcg
cttgccacctgggcggccatgtgtgccggcacgtgcggcatcggcccgatcacgcacttc
gataccgatgcgtttaccgtcaaggtggcggccgaggtcaagggctttgacggcaacgag
tactttggcaagcgtgacgccaagcatctggacccctgcgttcagtttgcgatggcggct
tcggacgaggcaatgcacgatgcgggctttgatgtcgaaggcgccatcgatcgcgagcgc
ctgggcgtttacgtggggtcgggcgtgggcggcatgcagacgctcgtcgacaacgtccat
acgattgccgaccgtgggccccgccgcgcatcgccttacatgatcgcgatgatgatcccc
aacatggcatcgggcaatatcgcaatccgtcacaaggcaaagggaccgaccctgcccgtc
gtgaccgcttgcgcgacgtctgcccatgcggtgggcgaggcgttccgcgccatcaagcac
ggctatgccgacgcgatcctcgcgggcggcgccgaggcggccattatccccgacgccgtt
gcaggctttacgtcctgccgcgcattgaccaccaaccccgatcccgcgacggcttgccgc
ccgttcgatgcagaccgtgacggctttgtgatgggcgagggcgcctgcgtgttggtactc
gagagcatggaacatgcgcaggcgcgcggtgcgcacatttatgccgaggtcgtgggctac
ggcaacaccgatgatgcctatcacatcacgagccccgatcccgaggctgccggcattgcc
cgcgcgatatcgctggcggttgccgagggcgacgtcaagccttccgagggtctctacatc
aatgcccacggcacctcgaccaggctcaacgattcgtccgagacggcgggcattaagcgt
gcgctcggcgaggacgcggcacgcgccgcgcacgtctcgtcgaccaagtcgatgaccggc
cacatgatcggtgccacgggtgccatcgaggtcatggcctgtgccatggcgctcgagcag
ggcgtggtacctccgaccattaactaccacactcccgatcccgcctgcgatcttgattac
acgcccaatcgcgcggttcgcgccgaccttacctgggcgctttcgaccaacctgggcttt
ggcggccacaacgctgccatcgcgctgcgtagatatgcgaggagctag
DBGET
integrated database retrieval system