KEGG   Collinsella aerofaciens: CSV91_05260
Entry
CSV91_05260       CDS       T05143                                 
Symbol
fabF
Name
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
caer  Collinsella aerofaciens
Pathway
caer00061  Fatty acid biosynthesis
caer00780  Biotin metabolism
caer01100  Metabolic pathways
caer01212  Fatty acid metabolism
caer01240  Biosynthesis of cofactors
Module
caer_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:caer00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CSV91_05260 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CSV91_05260 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:caer01004]
    CSV91_05260 (fabF)
Enzymes [BR:caer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     CSV91_05260 (fabF)
Lipid biosynthesis proteins [BR:caer01004]
 Fatty acid synthase
  Component type
   CSV91_05260 (fabF)
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Other DBs
NCBI-ProteinID: ATP53997
UniProt: A0A2D1TXC3
LinkDB
Position
complement(1192958..1194205)
AA seq 415 aa
MEQRVAITGIGAVSPLGNTALATWAAMCAGTCGIGPITHFDTDAFTVKVAAEVKGFDGNE
YFGKRDAKHLDPCVQFAMAASDEAMHDAGFDVEGAIDRERLGVYVGSGVGGMQTLVDNVH
TIADRGPRRASPYMIAMMIPNMASGNIAIRHKAKGPTLPVVTACATSAHAVGEAFRAIKH
GYADAILAGGAEAAIIPDAVAGFTSCRALTTNPDPATACRPFDADRDGFVMGEGACVLVL
ESMEHAQARGAHIYAEVVGYGNTDDAYHITSPDPEAAGIARAISLAVAEGDVKPSEGLYI
NAHGTSTRLNDSSETAGIKRALGEDAARAAHVSSTKSMTGHMIGATGAIEVMACAMALEQ
GVVPPTINYHTPDPACDLDYTPNRAVRADLTWALSTNLGFGGHNAAIALRRYARS
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggaacagagagttgcaatcaccggcatcggtgccgtatcgccgctcggcaacaccgcg
cttgccacctgggcggccatgtgtgccggcacgtgcggcatcggcccgatcacgcacttc
gataccgatgcgtttaccgtcaaggtggcggccgaggtcaagggctttgacggcaacgag
tactttggcaagcgtgacgccaagcatctggacccctgcgttcagtttgcgatggcggct
tcggacgaggcaatgcacgatgcgggctttgatgtcgaaggcgccatcgatcgcgagcgc
ctgggcgtttacgtggggtcgggcgtgggcggcatgcagacgctcgtcgacaacgtccat
acgattgccgaccgtgggccccgccgcgcatcgccttacatgatcgcgatgatgatcccc
aacatggcatcgggcaatatcgcaatccgtcacaaggcaaagggaccgaccctgcccgtc
gtgaccgcttgcgcgacgtctgcccatgcggtgggcgaggcgttccgcgccatcaagcac
ggctatgccgacgcgatcctcgcgggcggcgccgaggcggccattatccccgacgccgtt
gcaggctttacgtcctgccgcgcattgaccaccaaccccgatcccgcgacggcttgccgc
ccgttcgatgcagaccgtgacggctttgtgatgggcgagggcgcctgcgtgttggtactc
gagagcatggaacatgcgcaggcgcgcggtgcgcacatttatgccgaggtcgtgggctac
ggcaacaccgatgatgcctatcacatcacgagccccgatcccgaggctgccggcattgcc
cgcgcgatatcgctggcggttgccgagggcgacgtcaagccttccgagggtctctacatc
aatgcccacggcacctcgaccaggctcaacgattcgtccgagacggcgggcattaagcgt
gcgctcggcgaggacgcggcacgcgccgcgcacgtctcgtcgaccaagtcgatgaccggc
cacatgatcggtgccacgggtgccatcgaggtcatggcctgtgccatggcgctcgagcag
ggcgtggtacctccgaccattaactaccacactcccgatcccgcctgcgatcttgattac
acgcccaatcgcgcggttcgcgccgaccttacctgggcgctttcgaccaacctgggcttt
ggcggccacaacgctgccatcgcgctgcgtagatatgcgaggagctag

DBGET integrated database retrieval system