Citrobacter amalonaticus FDAARGOS_165: AL524_01535 Help Entry AL524_01535       CDS       T04738                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism caf  Citrobacter amalonaticus FDAARGOS_165 Pathway caf01100   Metabolic pathways caf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:caf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AL524_01535    00074 Mycolic acid biosynthesis     AL524_01535   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AL524_01535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GshA Motif Other DBs NCBI-ProteinID:  AMG51879 UniProt:  A0AAP5RSD6 LinkDB All DBs Position 236560..236811 Genome browser AA seq 83 aa AA seqDB search MTDQHAIYNEVSALLVKLFEIDPQEIKPEARLYDDLELDSIDAVDMIVHLQKKTGKKIKP EEFKAVRTVQDVVDAVERLLKEA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccgatcaacacgccatttataacgaagtctctgcgctgctggttaagctgtttgag atagacccgcaggagatcaaacctgaagcgcgtctgtacgacgatcttgagctggacagc atcgacgccgtcgacatgatagtccatctgcaaaagaaaaccggtaagaagatcaaaccg gaagagttcaaagccgtacgcaccgtgcaggatgtcgttgacgcggtagaacgcctgctt aaagaagcctga

DBGET integrated database retrieval system