Citrobacter amalonaticus FDAARGOS_165: AL524_09075 Help Entry AL524_09075       CDS       T04738                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism caf  Citrobacter amalonaticus FDAARGOS_165 Brite KEGG Orthology (KO) [BR:caf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:caf03400]     AL524_09075 DNA repair and recombination proteins [BR:caf03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     AL524_09075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  AMG53227 UniProt:  A0AAX2BQV3 LinkDB All DBs Position 1879057..1879290 Genome browser AA seq 77 aa AA seqDB search MKVELTIDRTKELPKGALPALEKELLKRLNHQYEDCSLIIRRAGSDGLSVFGADKDDKKK IEKILQETWESADDWFY NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaaagttgaattaaccattgatcgcacgaaagaacttccaaagggtgcgctgccagca ctggagaaagaactactgaagcgccttaatcatcagtatgaggattgcagtctaataatt cggcgggctggttctgacggtttgagcgttttcggggctgataaggacgacaaaaagaaa attgagaagatcctccaggaaacctgggaaagcgctgacgactggttttactga

DBGET integrated database retrieval system