KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_13850
Entry
AL524_13850       CDS       T04738                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00190  Oxidative phosphorylation
caf01100  Metabolic pathways
caf02020  Two-component system
caf04148  Efferocytosis
Module
caf_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:caf00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AL524_13850 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL524_13850 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    AL524_13850 (petA)
Enzymes [BR:caf01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     AL524_13850 (petA)
SSDB
Motif
Pfam: Rieske UCR_Fe-S_N DUF6069
Other DBs
NCBI-ProteinID: AMG56027
LinkDB
Position
complement(2845403..2845954)
AA seq 183 aa
MVENKQPDKDIQQQRRNCLCKLTKFVGAAGVTAAVWPLISALGPDETTRGENEPIDVSLA
GIAAGQTLRRIWQGKLILIHHRTPEEIVAARTGDHSTLVDPQSDSERVASDYPQWLVVQG
YCPHAGCVPNTRPGGQGWICPCHGSEFDTSGRVTRGPATTNLAVPEFAFHPDGLTVRIGA
KDV
NT seq 552 nt   +upstreamnt  +downstreamnt
gtggtggagaacaaacagccggataaagacattcagcagcaacgacgcaactgcctgtgc
aaattgacaaaatttgttggcgcagcgggagtgaccgccgccgtctggccgttaatttcc
gcattagggccggacgaaacaacgcgcggagaaaatgagccgatagacgtctcgctggcg
gggatcgccgcaggacaaaccctcagacgcatctggcaagggaagctgatcctcatccat
catcgcacgccggaagagattgtcgcggcccgcacgggtgaccacagcacgcttgtcgat
ccgcaatcggacagcgaacgggtcgcgtctgactatccgcagtggctggttgttcagggg
tattgtccgcatgccggctgtgttcccaataccagacccggtggacagggctggatttgc
ccgtgtcacggttcggagtttgatacgtccggacgggtcacccgcggccccgcaaccact
aatctggccgttcctgagtttgcctttcatcctgatggtctgaccgtgcgtataggcgct
aaggacgtgtga

DBGET integrated database retrieval system