Citrobacter amalonaticus FDAARGOS_165: AL524_16880 Help Entry AL524_16880       CDS       T04738                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism caf  Citrobacter amalonaticus FDAARGOS_165 Pathway caf01100   Metabolic pathways caf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:caf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AL524_16880    00074 Mycolic acid biosynthesis     AL524_16880   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AL524_16880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AMG54637 UniProt:  A0A2S4RYM2 LinkDB All DBs Position complement(3501513..3501749) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system