Citrobacter amalonaticus FDAARGOS_165: AL524_20705 Help Entry AL524_20705       CDS       T04738                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism caf  Citrobacter amalonaticus FDAARGOS_165 Brite KEGG Orthology (KO) [BR:caf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:caf03032]     AL524_20705    03036 Chromosome and associated proteins [BR:caf03036]     AL524_20705    03400 DNA repair and recombination proteins [BR:caf03400]     AL524_20705 DNA replication proteins [BR:caf03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AL524_20705 Chromosome and associated proteins [BR:caf03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AL524_20705 DNA repair and recombination proteins [BR:caf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AL524_20705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AMG55305 UniProt:  A0A0X8S5X7 LinkDB All DBs Position complement(4291489..4291761) Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTG RNPQTGKEIAIAAAKVPGFRAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaatctcaactgatcgacaaaattgctgcaggggctgatatctccaaagctgcg gcagggcgtgcgttagacgcaattattgcttctgttaccgaatctctgaaagaaggggat gacgttgcgctggtaggttttggtacttttgctgttaaagagcgtgctgcccgtactggc cgcaacccgcaaacaggtaaagagatcgccattgctgccgccaaagtacctggtttccgt gcaggtaaagcactgaaagacgcagtaaactaa

DBGET integrated database retrieval system