Chloroflexus aggregans: Cagg_0284 Help Entry Cagg_0284         CDS       T00824                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cag  Chloroflexus aggregans Pathway cag01100   Metabolic pathways cag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cag00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Cagg_0284    00074 Mycolic acid biosynthesis     Cagg_0284   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Cagg_0284 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ACL23232 UniProt:  B8G2S8 LinkDB All DBs Position 355216..355464 Genome browser AA seq 82 aa AA seqDB search MASPEMEERLRKIIVDQLGVDEAQVVPSASFTKDLNADSLDLVELIMSIEEEFGVEIPDE DAEKIQTVADALQYLETHQSNE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcttcgcccgagatggaggaacgcctgcgcaagattattgtcgatcagctcggcgtg gatgaagcgcaggttgtgccgagcgcatcgtttacgaaggatttaaacgccgactcgctc gatttggtcgaactgattatgtcaattgaagaagagttcggtgtcgagattcctgatgaa gatgccgagaagattcagacggtcgccgatgcgctccagtatcttgaaacgcatcagagt aatgagtag

DBGET integrated database retrieval system