Chloroflexus aggregans: Cagg_3118
Help
Entry
Cagg_3118 CDS
T00824
Name
(GenBank) ABC transporter related
KO
K24989
putative thiamine transport system ATP-binding protein
Organism
cag
Chloroflexus aggregans
Brite
KEGG Orthology (KO) [BR:
cag00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
cag02000
]
Cagg_3118
Transporters [BR:
cag02000
]
ABC transporters, prokaryotic type
Mineral and organic ion transporters
Putative thiamine transporter
Cagg_3118
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_16
AAA_21
nSTAND1
AAA_29
AAA
AAA_33
AAA_22
RsgA_GTPase
AAA_28
NB-ARC
SMC_N
nSTAND3
AAA_25
NACHT
AAA_23
MMR_HSR1
RuvB_N
T4SS-DNA_transf
DEAD
DLIC
FeoB_N
Motif
Other DBs
NCBI-ProteinID:
ACL25976
UniProt:
B8G7E1
LinkDB
All DBs
Position
3777806..3778570
Genome browser
AA seq
254 aa
AA seq
DB search
MSILELRAISKTFASPTGPVQVLDRLSMQVAAGEFVAVIGPSGSGKTTLFNIIAGLELPD
AGAVLIDGIEVTGRRGQVAYMPQRDALLPWLSVIENAVLATVVQGGDVAAARREARALLA
DFGLQGWGDARPALLSGGMRQRAAFLRTVLWHRPIMLLDEPFGALDALTRAQLQQWLLTL
WDRLDRTVVLVTHDIDEAIILADRIYVLTPRPARIALEVRVDLPRPRSYALVTDPAFVRL
KRQLQQVLMDGERR
NT seq
765 nt
NT seq
+upstream
nt +downstream
nt
atgtcaatactcgaacttcgtgcgatcagtaagaccttcgcatcgccaaccggtccggtt
caggtgctcgaccggctgagtatgcaggtcgcggcgggcgagtttgtcgccgttattggt
ccgagcgggagtggaaaaacgaccctcttcaacatcattgccggccttgaattgcctgat
gccggtgcagtgctgatcgatgggattgaggtgaccggtcggcgcgggcaggtggcgtat
atgccgcaacgcgacgcactgttgccgtggctgtcggtgatcgagaatgcggtgttggcg
acggttgtgcagggtggcgatgttgccgcggcccgccgcgaggcgcgtgcgttgctggcc
gatttcggcttgcaaggctggggtgatgcccgccctgctcttttgtcaggtgggatgcgt
cagcgcgccgcttttttacgcaccgtcctctggcatcgcccgattatgctgctcgacgaa
cctttcggtgcgctcgatgcacttacccgggctcagttgcagcaatggctgctgacgctc
tgggatcggttggatcgcaccgtcgtgctcgttactcacgacatcgatgaggcgatcatt
ctcgccgaccgtatctatgtcctcacgccgcgcccggcgcggatcgcgttggaagtgcgg
gtcgatctaccacgaccgcgctcgtatgcactcgtcaccgacccagcgtttgtgcggctc
aaacggcagttgcagcaagttttgatggacggtgagcgacgatga
DBGET
integrated database retrieval system