Caulobacter sp. K31: Caul_0636 Help Entry Caul_0636         CDS       T00651                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism cak  Caulobacter sp. K31 Pathway cak00190   Oxidative phosphorylation cak01100   Metabolic pathways cak02020   Two-component system Module cak_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:cak00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Caul_0636  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Caul_0636 Enzymes [BR:cak01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Caul_0636 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ABZ69769 UniProt:  B0T7N1 LinkDB All DBs Position 706298..706420 Genome browser AA seq 40 aa AA seqDB search MWYFTWILGLGLALAFGVLNGVWYEFNLTDDGDLGVSEDT NT seq 123 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcacctggattttgggcctgggcctggcgctggccttcggcgttctgaac ggcgtctggtacgagttcaacctgaccgacgacggggatcttggggtttcggaagacacc tga

DBGET integrated database retrieval system