Caulobacter sp. K31: Caul_2519 Help Entry Caul_2519         CDS       T00651                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cak  Caulobacter sp. K31 Pathway cak01100   Metabolic pathways cak01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cak00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Caul_2519    00074 Mycolic acid biosynthesis     Caul_2519   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Caul_2519 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ABZ71646 UniProt:  B0SWL8 LinkDB All DBs Position 2733319..2733558 Genome browser AA seq 79 aa AA seqDB search MSDILERVRKIVIEHLDADPEKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFITEKTGA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgacattctcgagcgcgtgcgtaagatcgtcatcgagcacctggacgccgatccg gaaaaggtcaccgaaaaggccagcttcatcgacgacctgggcgccgacagcctcgacaac gtcgagctggtcatggcgttcgaagaagaattcgacatcgaaattccggatgacgccgcc gagcacatccagaccgtcggtgacgccgtgaagttcatcacggaaaagaccggcgcttaa

DBGET integrated database retrieval system