Candida albicans: CAALFM_C107410CA Help Entry CAALFM_C107410CA  CDS       T00189                                  Symbol SKP1, CaO19.4427 Name (RefSeq) SCF ubiquitin ligase subunit   KO K03094   S-phase kinase-associated protein 1 Organism cal  Candida albicans Pathway cal03083   Polycomb repressive complex cal04111   Cell cycle - yeast cal04120   Ubiquitin mediated proteolysis cal04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cal00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     CAALFM_C107410CA (SKP1)    04120 Ubiquitin mediated proteolysis     CAALFM_C107410CA (SKP1)   09126 Chromosome    03083 Polycomb repressive complex     CAALFM_C107410CA (SKP1)  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     CAALFM_C107410CA (SKP1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cal04131]     CAALFM_C107410CA (SKP1)    04121 Ubiquitin system [BR:cal04121]     CAALFM_C107410CA (SKP1)    03036 Chromosome and associated proteins [BR:cal03036]     CAALFM_C107410CA (SKP1) Membrane trafficking [BR:cal04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     CAALFM_C107410CA (SKP1) Ubiquitin system [BR:cal04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      CAALFM_C107410CA (SKP1)    Cul7 complex      CAALFM_C107410CA (SKP1) Chromosome and associated proteins [BR:cal03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      CAALFM_C107410CA (SKP1)   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      CAALFM_C107410CA (SKP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  3644485 NCBI-ProteinID:  XP_713872 UniProt:  Q59WE2 LinkDB All DBs Position 1:complement(1604432..1604926) Genome browser AA seq 164 aa AA seqDB search MSSPKVIIVSSDNEKFPVEPKIAEKSILIKNMINDLHPDGLEEDFEIPTPNVRANVLCKV LEWCEHHKNTVFQDDEDEDAKKSVPVEEWDRNFLKVDQEMLYEIILAANYLNIKPLLESG CKMVAEMIKSKSPEELRRTFNIINDFSPEEEAAIRKENEWAEDR NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgtcatctcctaaggttattattgtttcttcagataatgaaaagttcccagttgaacca aagattgctgaaaagtccattttgattaaaaacatgatcaatgatttacatccagacgga ttggaagaagattttgaaattccaactcctaatgttagagccaatgtattatgtaaagtg ttagaatggtgtgaacatcataaaaacactgtattccaagatgatgaagatgaagatgct aagaaatctgtgcctgttgaagaatgggacagaaatttcttgaaagttgatcaagaaatg ctttacgaaattatcttagctgccaactacttgaacatcaaaccattattggaaagtgga tgtaagatggttgctgaaatgatcaagagtaaatcaccagaagagttaagaagaactttt aacattatcaatgatttcagtcctgaagaagaagctgccattagaaaagaaaatgaatgg gctgaagatagataa

DBGET integrated database retrieval system