Chenopodium album (lamb's quarters): 145636599 Help Entry 145636599         CDS       T11950                                  Symbol LOC145636599 Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism calb  Chenopodium album (lamb's quarters) Pathway calb03018   RNA degradation calb03040   Spliceosome Brite KEGG Orthology (KO) [BR:calb00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     145636599 (LOC145636599)   09123 Folding, sorting and degradation    03018 RNA degradation     145636599 (LOC145636599)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:calb03019]     145636599 (LOC145636599)    03041 Spliceosome [BR:calb03041]     145636599 (LOC145636599) Messenger RNA biogenesis [BR:calb03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      145636599 (LOC145636599)   mRNA degradation factors    5'-3' decay     Lsm complex      145636599 (LOC145636599) Spliceosome [BR:calb03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     145636599 (LOC145636599) SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  145636599 NCBI-ProteinID:  XP_081544316 LinkDB All DBs Position 1:4528640..4532169 Genome browser AA seq 98 aa AA seqDB search MSAGPGLEPLVDQMISVITNDGRNIVGILKGFDQATNIILDESHERVFSTKEGVQQIVLG LYIIRGDNISIIGELDEDLDAHIELSQVRGHPLKPVIH NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctgctggacctggacttgagcctcttgtagatcagatgatctcagttattaccaat gatggacgcaacatagtgggaatcttaaaaggttttgaccaggcaacaaatattattctt gatgaatcacatgagagggttttttctaccaaggaaggagtccaacaaattgtattgggt ttgtacatcatcaggggtgacaacataagcattattggtgagctagatgaagacttagat gctcatattgagctatcgcaagtgaggggccatcctctgaagcctgtcattcactga

DBGET integrated database retrieval system