Caloramator sp. Dgby_cultured_2: PWK10_06505 Help Entry PWK10_06505       CDS       T09567                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cald  Caloramator sp. Dgby_cultured_2 Pathway cald01100   Metabolic pathways cald01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cald00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PWK10_06505 (acpP)    00074 Mycolic acid biosynthesis     PWK10_06505 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PWK10_06505 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WDU84058 LinkDB All DBs Position complement(971347..971580) Genome browser AA seq 77 aa AA seqDB search MIFEKIKERISDILGVDPDDITMDSHFIDDLGADSLDIVELIMALEEDFDLEIPDEDAEK LQTVGDVVDYIKEHTDI NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgatattcgaaaaaataaaagaaagaatttcagacatattaggagtagatccagacgat ataactatggattcacattttattgatgatttaggtgctgattcattagacatagtagag cttattatggctcttgaggaagattttgatttagaaattccagatgaggatgctgaaaag ttgcaaacagtaggtgatgttgtagattacataaaggaacataccgacatataa

DBGET integrated database retrieval system