Caloramator sp. E03: FDN13_00210 Help Entry FDN13_00210       CDS       T05994                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cale  Caloramator sp. E03 Pathway cale01100   Metabolic pathways cale01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cale00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FDN13_00210 (acpP)    00074 Mycolic acid biosynthesis     FDN13_00210 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FDN13_00210 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Helicase_PWI Motif Other DBs NCBI-ProteinID:  QCX32243 UniProt:  A0A5B7TFJ2 LinkDB All DBs Position 39838..40071 Genome browser AA seq 77 aa AA seqDB search MIFEKVKERISDILGVDSDDITMESSFIDDLGADSLDIVELIMALEEEFDIEIPDEDAEK IQTVGDVVEYIKEHTDM NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgatatttgaaaaagtgaaagaaagaatttcagatatacttggagttgattctgatgat ataaccatggaatcatcatttattgatgatcttggtgcagattctcttgatatcgttgag cttattatggctcttgaagaggaatttgatatagaaattccagatgaagatgctgaaaaa attcaaactgttggtgatgtagtggagtacataaaggaacatacagatatgtaa

DBGET integrated database retrieval system