Coraliomargarita algicola: SH580_14490 Help Entry SH580_14490       CDS       T10130                                  Symbol queF Name (GenBank) preQ(1) synthase   KO K09457   7-cyano-7-deazaguanine reductase [EC:1.7.1.13] Organism calg  Coraliomargarita algicola Pathway calg00790   Folate biosynthesis calg01100   Metabolic pathways Module calg_M00988   PreQ1 biosynthesis, GTP => 7-Aminomethyl-7-deazaguanine Brite KEGG Orthology (KO) [BR:calg00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     SH580_14490 (queF)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:calg03016]     SH580_14490 (queF) Enzymes [BR:calg01000]  1. Oxidoreductases   1.7  Acting on other nitrogenous compounds as donors    1.7.1  With NAD+ or NADP+ as acceptor     1.7.1.13  preQ1 synthase      SH580_14490 (queF) Transfer RNA biogenesis [BR:calg03016]  Prokaryotic type   tRNA modification factors    Other tRNA modification factors     SH580_14490 (queF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  QueF QueF_N Motif Other DBs NCBI-ProteinID:  WPJ94641 LinkDB All DBs Position 3536330..3536704 Genome browser AA seq 124 aa AA seqDB search MDIETFPNPNPERNYTIQHIQEEFTSTCPMTGHPDYATVVFSYAPDEVCIELKAMKLYLH SFRNKGIFFEAATNQIFEDLFAVCKPRWARLETIWRGRGGIRSNVVVEDAQEGYDGPTTF PFSA NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggacattgaaacatttcccaatccgaacccggagcgcaactacacgattcagcatatt caggaggagtttacttctacctgcccgatgacggggcacccggactatgccactgtcgtg tttagctatgcgccggatgaggtctgcatcgagcttaaggcgatgaagctgtatctgcac agttttcgcaataaggggatcttctttgaggcggccaccaatcagattttcgaagactta tttgcggtttgtaagccacgctgggcgcgcttggagaccatctggcgcgggcgcggtggc atacgctccaacgtggtggttgaagatgcgcaagagggctatgatggcccgacgactttt cccttttcggcctag

DBGET integrated database retrieval system