Calothrix sp. 336/3: IJ00_15805 Help Entry IJ00_15805        CDS       T03937                                  Name (GenBank) prohead protease   KO K03116   sec-independent protein translocase protein TatA Organism calh  Calothrix sp. 336/3 Pathway calh03060   Protein export calh03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:calh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     IJ00_15805  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     IJ00_15805  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:calh02044]     IJ00_15805 Secretion system [BR:calh02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    IJ00_15805 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AKG22542 UniProt:  A0A0T7BTU9 LinkDB All DBs Position complement(3773154..3773330) Genome browser AA seq 58 aa AA seqDB search MPFGLGWAEVAVISVVVLLVFGPKKIPELGSALGKTLRGFKEELKNPQDTASSEQDNL NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atgccatttggacttggatgggcagaagttgcagtgatttccgttgttgttctattagtc ttcggaccaaaaaaaattcccgaactaggtagcgctttgggtaaaaccctccgaggattt aaggaagaattgaaaaatccccaggatacagctagttcggaacaagataacttatag

DBGET integrated database retrieval system