Candidatus Chlorohelix allophototropha: OZ401_001016 Help Entry OZ401_001016      CDS       T09929                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism call  Candidatus Chlorohelix allophototropha Pathway call00020   Citrate cycle (TCA cycle) call00720   Other carbon fixation pathways call01100   Metabolic pathways call01110   Biosynthesis of secondary metabolites call01120   Microbial metabolism in diverse environments call01200   Carbon metabolism call01210   2-Oxocarboxylic acid metabolism Module call_M00009   Citrate cycle (TCA cycle, Krebs cycle) call_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:call00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     OZ401_001016   09102 Energy metabolism    00720 Other carbon fixation pathways     OZ401_001016 Enzymes [BR:call01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      OZ401_001016 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_6 Fer4_10 Fer4_21 Fer4_9 Fer4_16 Fer4_8 Fer4_4 Fer4_15 Fer4_3 Fer4_13 Fer4_22 Fer4_17 Motif Other DBs NCBI-ProteinID:  WJW67741 LinkDB All DBs Position 1:complement(1217419..1217667) Genome browser AA seq 82 aa AA seqDB search MRGTIVIDENRCKGCSLCTTVCPKEIIHIADCITPRGYHPAHLVDPQNLCTGCLLCSTIC PDTAITVYRESARKQSAAALVS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgcgggacaatcgtcattgacgaaaacaggtgtaaaggctgttcgctttgcactacc gtctgtcccaaagagataatccatatagcggattgcattactccgcgtggttatcacccc gctcatctggtagacccacagaatctttgcaccggatgtctgctttgttccactatatgc cctgatactgcaataaccgtttatcgcgaaagcgcccgaaaacagagcgccgcggcttta gtttcctga

DBGET integrated database retrieval system