Calothrix sp. NIES-2098: NIES2098_57560 Help Entry NIES2098_57560    CDS       T08374                                  Name (GenBank) hypothetical protein   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism caln  Calothrix sp. NIES-2098 Pathway caln03020   RNA polymerase Brite KEGG Orthology (KO) [BR:caln00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     NIES2098_57560  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:caln03021]     NIES2098_57560    03400 DNA repair and recombination proteins [BR:caln03400]     NIES2098_57560 Enzymes [BR:caln01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      NIES2098_57560 Transcription machinery [BR:caln03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      NIES2098_57560 DNA repair and recombination proteins [BR:caln03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       NIES2098_57560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 DUF961 Motif Other DBs NCBI-ProteinID:  BAY12568 LinkDB All DBs Position 6942068..6942304 Genome browser AA seq 78 aa AA seqDB search MLKRSKFETTQSQIMHRAEDLISAASNRYRITVQVANRAKRRRYEDFESAEDAMMKPVLR AIIEMSDELTQPEIIGEV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgctcaagcgttctaagttcgagacaactcagtctcagattatgcaccgtgccgaggat ctaattagtgcagcctccaatcggtatcgcattacggttcaggtggcaaaccgtgccaag cgtcgccgctatgaagattttgaaagtgcagaagatgcaatgatgaaaccagtactccgg gcaattatcgaaatgtccgatgaactgactcagccagagattattggcgaagtataa

DBGET integrated database retrieval system