Calothrix sp. NIES-3974: NIES3974_11050
Help
Entry
NIES3974_11050 CDS
T09641
Name
(GenBank) phosphonate ABC transport ATP-binding component
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
cals
Calothrix sp. NIES-3974
Pathway
cals02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
cals00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
NIES3974_11050
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
cals02000
]
NIES3974_11050
Enzymes [BR:
cals01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
NIES3974_11050
Transporters [BR:
cals02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
NIES3974_11050
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
SMC_N
nSTAND1
RsgA_GTPase
MMR_HSR1
AAA_29
AAA_16
AAA_22
Motif
Other DBs
NCBI-ProteinID:
BAZ04466
LinkDB
All DBs
Position
complement(1392306..1393079)
Genome browser
AA seq
257 aa
AA seq
DB search
MNIPSFQYPQNPTKETVIECLGLESVYSQNLQRPILNGIDCRVQRGEFVALLGLNGAGKS
SLLRSLIGLMPITRGKIVINGTPLSSHTLSPIRRQVGMLFQGGGLIPQLSVIDNVLCGKL
GNLKPQHTLFGFPKQDRRQGIELLERLGLREHVYQKVYQLSGGQQQRVAIARALIQSPSI
LLADEPTTGLDVVASQQVMETLATLNYDKGITIVAVLHDLGIARQYAHRAIILDAGKVVY
DGECDQLQDKFMQMVTN
NT seq
774 nt
NT seq
+upstream
nt +downstream
nt
gtgaacattccatccttccagtatccccaaaatcccacgaaagaaaccgtaatcgagtgt
ttaggtttagagagcgtctattctcaaaacctacagcgtccgattctgaatggaatcgat
tgtcgggttcaacggggggaatttgtcgctttgttaggattaaacggagctggaaaatct
agcctactgcgatcgctaatcggattaatgccaattacgcggggtaagattgtcatcaat
ggtactcccttaagttcccacaccctatcccctatccgtcgtcaagtgggaatgttgttt
caaggaggaggtttaataccgcaactatcagtaattgataatgttttgtgtggtaaatta
ggaaacctcaaaccccagcacaccctatttggatttccgaagcaagaccgtcgtcaagga
atagaattactagagcggttagggttgcgtgaacatgtgtatcaaaaagtttatcaactt
agtggtggacaacagcaacgggtggcgatcgcgcgagcattaattcaatcaccgtctata
ttgcttgcagatgaaccgacaaccggattggatgtggttgcatcgcagcaggtaatggaa
accttagcaaccctgaattatgacaagggaatcaccatagttgcggttttacacgatttg
ggaattgccagacaatatgcccatcgggctattattctagatgcaggaaaggttgtttat
gatggggagtgcgaccagttgcaggacaagtttatgcaaatggttacaaattga
DBGET
integrated database retrieval system