Cicer arietinum (chickpea): 101494277 Help Entry 101494277         CDS       T02819                                  Name (RefSeq) SKP1-like protein 14   KO K03094   S-phase kinase-associated protein 1 Organism cam  Cicer arietinum (chickpea) Pathway cam03083   Polycomb repressive complex cam04120   Ubiquitin mediated proteolysis cam04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cam00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101494277    04120 Ubiquitin mediated proteolysis     101494277   09126 Chromosome    03083 Polycomb repressive complex     101494277  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cam04131]     101494277    04121 Ubiquitin system [BR:cam04121]     101494277    03036 Chromosome and associated proteins [BR:cam03036]     101494277 Membrane trafficking [BR:cam04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     101494277 Ubiquitin system [BR:cam04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      101494277    Cul7 complex      101494277 Chromosome and associated proteins [BR:cam03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      101494277   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      101494277 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ APC1_C DUF1722 Motif Other DBs NCBI-GeneID:  101494277 NCBI-ProteinID:  XP_004517085 UniProt:  A0A1S2Z8R1 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search MAAEKSSMITLVAADNSVFEVEANIAKEMKTVQSYIDEFDQNTVQIPLPNVFSNDLAMII EYCKKHASEEESKEAKEEFDVEFVKRMKSDDKLRLIQAASYLNIESLLQFLAKAIADEIK NQSVEFVRDYFHIENDFTPEEESELRKENEWAFK NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggctgcagaaaaatcatcaatgatcacgttggtggccgcagacaactctgtttttgag gtagaagctaatatcgcgaaggagatgaaaaccgtacaatcttatatcgacgaattcgat caaaacaccgttcaaattcctctacctaatgtattcagcaacgatctcgccatgataatc gagtattgtaagaaacacgcttcagaggaagaatctaaagaagcaaaagaggagtttgat gttgaattcgtgaagaggatgaaaagcgatgacaaattacggctcattcaggcggcaagt tatctcaacattgaaagtcttcttcaatttttggcaaaggctattgctgatgaaattaaa aaccagagtgtggaatttgttcgtgactattttcacatcgagaatgattttacgccggag gaagaatccgagttacgcaaagagaatgaatgggcttttaaatag

DBGET integrated database retrieval system