Cicer arietinum (chickpea): 101494819 Help Entry 101494819         CDS       T02819                                  Name (RefSeq) ras-related protein RHN1-like   KO K07887   Ras-related protein Rab-5A Organism cam  Cicer arietinum (chickpea) Pathway cam04144   Endocytosis cam04145   Phagosome cam04148   Efferocytosis Brite KEGG Orthology (KO) [BR:cam00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101494819    04145 Phagosome     101494819    04148 Efferocytosis     101494819  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cam04131]     101494819   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cam04147]     101494819    04031 GTP-binding proteins [BR:cam04031]     101494819 Membrane trafficking [BR:cam04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     101494819  Endosome - Lysosome transport     101494819 Exosome [BR:cam04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101494819   Exosomal proteins of other body fluids (saliva and urine)    101494819   Exosomal proteins of colorectal cancer cells    101494819   Exosomal proteins of bladder cancer cells    101494819 GTP-binding proteins [BR:cam04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     101494819 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase DUF6720 Motif Other DBs NCBI-GeneID:  101494819 NCBI-ProteinID:  XP_012572113 UniProt:  A0A1S3E9N9 LinkDB All DBs Position Unknown AA seq 159 aa AA seqDB search FSDYQESTIGAAFFTQVLSLNEATVKFDIWDTAGQERYHSLAPMYYRGVYDITSMDSFVR AKKWVREVLRQANPNLIIFLVANKADLEEQRKVGNEEGEEYAKENGMSFFETSAKTAQNV NELFYEIAKRLAKANPARQTGIKLHGSTRETGRSRFCCS NT seq 480 nt NT seq  +upstreamnt  +downstreamnt ttttcggattaccaggaatcgacaattggagcagcattttttactcaggttttgtcatta aatgaagcaactgtgaaatttgatatatgggacacagcagggcaggaacgataccacagt ttggctcctatgtattaccgcggtgtatatgacattacaagcatggattcttttgtacgg gcaaagaagtgggttagagaagtgctaagacaagcaaatccaaatttgatcatatttttg gtggcaaacaaggctgatttggaagaacagagaaaagtaggaaatgaggagggggaggag tatgctaaagaaaatggcatgtctttctttgaaacttcagcgaaaaccgcacagaatgtc aatgagctcttctatgaaatagctaagagattggcaaaagccaaccctgcacgtcagact ggaatcaagctgcatggcagcacacgagaaactggaagaagccggttttgttgttcttaa

DBGET integrated database retrieval system