Cicer arietinum (chickpea): 101500013 Help Entry 101500013         CDS       T02819                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism cam  Cicer arietinum (chickpea) Pathway cam04145   Phagocytosis cam04517   IgSF CAM signaling cam04814   Motor proteins Brite KEGG Orthology (KO) [BR:cam00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     101500013  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     101500013   09142 Cell motility    04814 Motor proteins     101500013  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cam03037]     101500013    04812 Cytoskeleton proteins [BR:cam04812]     101500013 Cilium and associated proteins [BR:cam03037]  Motile cilia and associated proteins   Dynein arm    101500013 Cytoskeleton proteins [BR:cam04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      101500013 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  101500013 NCBI-ProteinID:  XP_004503373 UniProt:  A0A1S2YF44 LinkDB All DBs Position 6 Genome browser AA seq 128 aa AA seqDB search MEGAEKELERRSKFLKSLIKNKKTIEQQEQHFHNIKVRACDMPLNLQNRAFHCARHLLNS MPSNKLDSKRLALTLKKEFDTSYGPAWHCIVGTSFGSYVTHSVGGFLYFSIDKVYILLFK TTVQPLDH NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggaaggtgcagagaaggaactagagagaagaagcaagtttctgaaaagcttaataaag aacaagaaaacaattgaacaacaagaacaacacttccacaacataaaggtcagagcttgt gacatgcctctaaatttgcagaaccgtgcatttcattgtgcacgtcatctcttgaattct atgccatcaaacaagcttgatagtaaacgtcttgctctcacacttaagaaggaatttgac acttcctatggtccagcatggcactgcattgttggaactagctttggttcctatgtaact cattcagttggaggtttcttgtatttttccattgacaaagtttatatccttctcttcaag actactgttcaaccattagaccattga

DBGET integrated database retrieval system