KEGG   Cicer arietinum (chickpea): 101508600
Entry
101508600         CDS       T02819                                 
Name
(RefSeq) SKP1-like protein 14
  KO
K03094  S-phase kinase-associated protein 1
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam03083  Polycomb repressive complex
cam04120  Ubiquitin mediated proteolysis
cam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101508600
   04120 Ubiquitin mediated proteolysis
    101508600
  09126 Chromosome
   03083 Polycomb repressive complex
    101508600
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cam04131]
    101508600
   04121 Ubiquitin system [BR:cam04121]
    101508600
   03036 Chromosome and associated proteins [BR:cam03036]
    101508600
Membrane trafficking [BR:cam04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    101508600
Ubiquitin system [BR:cam04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     101508600
   Cul7 complex
     101508600
Chromosome and associated proteins [BR:cam03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     101508600
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     101508600
SSDB
Motif
Pfam: Skp1 Skp1_POZ YtxC FTCD
Other DBs
NCBI-GeneID: 101508600
NCBI-ProteinID: XP_004488769
UniProt: A0A1S2XIN8
LinkDB
Position
1:40975578..40976408
AA seq 156 aa
MAAEKSSIKIITLIAADGSVFEVEPNIVKEMKTVQSYIDELDQNTVSIPLPNVFGNDLAM
IIEYCKKHASEEETKEAKEEFDFEFVKRMKSDDKLRLLQAASYLNMESFLQFMAKAIAAE
IENQSVEFVRDYFQIESDFTPEEEAELRKENEWAFK
NT seq 471 nt   +upstreamnt  +downstreamnt
atggctgcagaaaaatcatcaataaagattatcacgctgatagcagccgacggctctgtt
tttgaggtagaacctaatatcgtgaaggagatgaaaaccgtacaatcttatatcgatgaa
ttagatcaaaacaccgtatcaattcctctccccaatgtattcggtaacgatcttgctatg
ataatcgagtattgtaagaaacacgcttcagaggaagaaactaaggaagcaaaagaggag
tttgattttgaattcgtgaagaggatgaaaagcgatgacaaattacgcctccttcaagct
gcaagttatctcaatatggaaagttttcttcaatttatggcaaaggctattgctgctgaa
attgaaaatcagagtgtggaatttgttcgtgactattttcagatcgagagtgattttacg
ccggaggaagaagctgagttacgcaaagagaatgaatgggcttttaaatag

DBGET integrated database retrieval system