Cicer arietinum (chickpea): 101510738 Help Entry 101510738         CDS       T02819                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A Organism cam  Cicer arietinum (chickpea) Pathway cam04144   Endocytosis cam04145   Phagosome cam04148   Efferocytosis Brite KEGG Orthology (KO) [BR:cam00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101510738    04145 Phagosome     101510738    04148 Efferocytosis     101510738  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cam04131]     101510738   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cam04147]     101510738    04031 GTP-binding proteins [BR:cam04031]     101510738 Membrane trafficking [BR:cam04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     101510738 Exosome [BR:cam04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101510738   Exosomal proteins of other body fluids (saliva and urine)    101510738   Exosomal proteins of colorectal cancer cells    101510738   Exosomal proteins of bladder cancer cells    101510738 GTP-binding proteins [BR:cam04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     101510738 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  101510738 NCBI-ProteinID:  XP_012573047 UniProt:  A0A1S3EB37 LinkDB All DBs Position 6:26799613..26801456 Genome browser AA seq 115 aa AA seqDB search MKSFENLNHWREEFLIQASPSDPENFPFVVLGNKIDVDGGNSRVISEKKAKAWCASKGNI PYFETSAKEGFNVEAAFQCIAKNALKNEPEEEMYLPDTIDVGSGGRQQRSTGCEC NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaaatcttttgaaaaccttaaccattggagagaagaatttctcattcaggctagtcca tctgaccctgaaaactttccttttgttgtcttgggaaacaaaatcgatgttgatggtgga aatagcagagttatttctgagaagaaagcaaaggcatggtgtgcttcaaagggaaacata ccatactttgagacatctgcaaaagaaggatttaatgttgaagctgctttccagtgtata gcaaaaaatgcactcaagaatgaacctgaagaagaaatgtatctgcctgacacaatcgat gtcggaagtggtggccgacaacagagatcgactggctgtgaatgttga

DBGET integrated database retrieval system