Cicer arietinum (chickpea): 101511190 Help Entry 101511190         CDS       T02819                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism cam  Cicer arietinum (chickpea) Pathway cam03083   Polycomb repressive complex cam04120   Ubiquitin mediated proteolysis cam04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cam00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101511190    04120 Ubiquitin mediated proteolysis     101511190   09126 Chromosome    03083 Polycomb repressive complex     101511190  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cam04131]     101511190    04121 Ubiquitin system [BR:cam04121]     101511190    03036 Chromosome and associated proteins [BR:cam03036]     101511190 Membrane trafficking [BR:cam04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     101511190 Ubiquitin system [BR:cam04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      101511190    Cul7 complex      101511190 Chromosome and associated proteins [BR:cam03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      101511190   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      101511190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  101511190 NCBI-ProteinID:  NP_001352204 UniProt:  A0A3Q7K7M8 LinkDB All DBs Position 8:6029236..6031122 Genome browser AA seq 155 aa AA seqDB search MSSTKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC KKHVEAASSDDKPTEDDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaacgaaaaagatcacccttaagagttccgatggagaggcctttgaggtcgat gaagcggtggctttggagtcacagacgattaagcacatgattgaagatgattgtgccgac agtggaattcctcttcctaacgtgacaagcaagatcttggcgaaggtaatcgagtattgt aagaaacatgttgaggctgcgagttctgatgataaacctactgaggatgatcttaaggct tgggatgctgattttgttaaggttgaccaggctacgctcttcgatctcatactggctgca aactacttgaacatcaagagccttcttgatcttacctgccagacagttgcagacatgata aaggggaagacacctgaagaaattcgcaagacttttaacatcaagaatgacttcacacct gaggaagaggaggaagttcgtagggagaatcaatgggcatttgaatga

DBGET integrated database retrieval system