Citrobacter amalonaticus Y19: F384_04870 Help Entry F384_04870        CDS       T03934                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism cama  Citrobacter amalonaticus Y19 Pathway cama01100   Metabolic pathways cama01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cama00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F384_04870    00074 Mycolic acid biosynthesis     F384_04870   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F384_04870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKE61847 UniProt:  A0A0F6TZG6 LinkDB All DBs Position 1082427..1082687 Genome browser AA seq 86 aa AA seqDB search MLNHEEVMDYTLHCLQGMVESGVDIHPDSDLVNDLGLESIKVMDLLMLLEDKFDISIPIN ILLDVRTPAQLMEALIPYLESINESL NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgttaaatcatgaagaagtaatggattacacccttcactgtctacagggtatggttgaa agcggtgtggatatccatcctgacagcgatctggtcaatgatcttgggctggaatcaatt aaagtcatggatttattaatgttgctggaagataaattcgatatttctatccccattaat attttgctggatgtcagaacacctgcgcaattaatggaagcgttaatcccttatctggag agtattaatgagtctttatga

DBGET integrated database retrieval system