Citrobacter amalonaticus Y19: F384_18865 Help Entry F384_18865        CDS       T03934                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cama  Citrobacter amalonaticus Y19 Pathway cama01100   Metabolic pathways cama01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cama00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F384_18865    00074 Mycolic acid biosynthesis     F384_18865   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F384_18865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKE60474 UniProt:  A0A0F6TXB2 LinkDB All DBs Position 4085207..4085464 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIITTLNLDELSTDDIDTEAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESEEMRQHFFSVATLASFINAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctttatcttgaaattaaaaatctcatcatcaccacattgaatctggacgaa ctgtcgacagacgacattgacaccgaggcggcgctgtttggcgacggtctgggactggac tcgattgatgccctggaactgggactggcggtaaaaaatcagtacggcgtggtgctttcc gcagaaagcgaagagatgcgtcagcacttcttctccgtcgccacgctggcatcgttcatt aatgcgcaacgtgcctga

DBGET integrated database retrieval system