Citrobacter amalonaticus Y19: F384_23110 Help Entry F384_23110        CDS       T03934                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cama  Citrobacter amalonaticus Y19 Pathway cama01100   Metabolic pathways cama01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cama00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F384_23110    00074 Mycolic acid biosynthesis     F384_23110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F384_23110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AKE61249 UniProt:  A0A0F6TYL9 LinkDB All DBs Position 4982400..4982651 Genome browser AA seq 83 aa AA seqDB search MSQHEMIYDKISEMICDAKDLSPEALTPETTLPELELDSLDYVELMVLAKREFNVTLNPE MFMKNPTMTLRELSQRIAQEMAG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagccagcatgaaatgatctacgacaaaatcagtgaaatgatctgcgacgcaaaagac ctgtcgccggaggcgctgacgcccgagacgacgctgccggaactggaactggacagtctc gactacgttgagctgatggtgctggcgaagcgtgaatttaacgtcacgcttaatcccgaa atgtttatgaaaaatccaaccatgacgcttcgcgaactcagccagcgcattgcgcaggaa atggcaggttga

DBGET integrated database retrieval system