Cobetia amphilecti: LCW13_04580 Help Entry LCW13_04580       CDS       T07922                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism camh  Cobetia amphilecti Pathway camh01100   Metabolic pathways camh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:camh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LCW13_04580 (acpP)    00074 Mycolic acid biosynthesis     LCW13_04580 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LCW13_04580 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  UBU49539 LinkDB All DBs Position 1070326..1070559 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNAKEEEIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYIVNHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaccattgaagaacgcgtcaagaaggttgtggctgagcgcctgaacgccaaagaa gaagaaatccagaactcttcctctttcactgaagacctgggcgccgattccctggacacc gtcgagctggtgatggctcttgaagaggaattcgatactgaaattcctgacgaagaagca gagaagatcaccaccgtgcaggaagctatcgattacatcgtcaaccaccagtaa

DBGET integrated database retrieval system