Cobetia amphilecti: LCW13_13445 Help Entry LCW13_13445       CDS       T07922                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism camh  Cobetia amphilecti Pathway camh01100   Metabolic pathways camh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:camh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LCW13_13445    00074 Mycolic acid biosynthesis     LCW13_13445   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LCW13_13445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  UBU48026 LinkDB All DBs Position 3198697..3198969 Genome browser AA seq 90 aa AA seqDB search MSAEQQTASREEIYAHVRSTLIELFEIDAADIHPEALLYEDLDIDSIDAVDLVVELKKFT GRRIEANDFKSVRSLDDVVTAVEQLMQRQA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgagcgctgagcaacagaccgcgtcccgcgaagagatctatgcccatgtgcgcagcacc ctgatcgagctgttcgagatcgatgccgctgacatccaccccgaggcgctgctctatgaa gacctcgacatcgacagcatcgatgcggtggacctggtggtcgaactcaagaagttcacc ggccgacgcatcgaagccaatgacttcaagagcgtacgcagcctcgatgacgtcgtgacc gccgtcgagcagctgatgcagcgccaggcatga

DBGET integrated database retrieval system