Campylobacter porcelli: CSUIS_0441 Help Entry CSUIS_0441        CDS       T05900                                  Name (GenBank) putative flagellar protein FlgJ   KO K02395   peptidoglycan hydrolase FlgJ Organism camy  Campylobacter porcelli Pathway camy02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:camy00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     CSUIS_0441  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:camy02035]     CSUIS_0441 Bacterial motility proteins [BR:camy02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     CSUIS_0441 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  ARR00280 UniProt:  A0A1X9SVK4 LinkDB All DBs Position 447137..447430 Genome browser AA seq 97 aa AA seqDB search MRVDTSVALNAYDAANTQNLGKERAIDDAALREQTDAFEAFLVKEVLDIALKNENPLFPK DPGDKIYNSMYNDAMSRALSGGFGFSQMLYDFLKARA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagagtagatacaagtgttgcgcttaatgcatatgacgcagcaaatacacaaaattta ggaaaagaaagagctatagatgacgcagcacttagggagcaaactgatgcttttgaggcg tttttggttaaagaggttttggatattgccttaaaaaatgaaaatccactatttccaaaa gacccaggagataaaatttataactcaatgtataatgatgcgatgagtagggcattaagc ggtggatttggattttcgcaaatgctatatgattttttaaaagccagagcctaa

DBGET integrated database retrieval system