Clinocottus analis (woolly sculpin): 137781592 Help Entry 137781592         CDS       T10471                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism cana  Clinocottus analis (woolly sculpin) Pathway cana04382   Cornified envelope formation cana05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cana00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     137781592  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     137781592  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cana04147]     137781592 Exosome [BR:cana04147]  Exosomal proteins   Exosomal proteins of microglial cells    137781592 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 CRISPR_Cas9_WED EH DUF2303 DEK_C Motif Other DBs NCBI-GeneID:  137781592 NCBI-ProteinID:  XP_068426554 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MTELEKCMESLITIFHHYADEDSDGKSLSKKEFSKLLETELPNFLKSQKDPKAVEKIRKD LDQNGDSKVDFEEFMSLVVGLSMSCEKMFVLHQQKKCKK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgactgagttagagaagtgcatggagtccctgattaccatcttccatcactatgccgat gaagacagtgatggaaaaagcttaagcaagaaagaattcagcaaactattagagacggag ttgcccaactttttgaaaagccagaaagaccccaaagctgtggagaagatcaggaaggat ctggaccaaaacggagattctaaggtggactttgaagagttcatgtccctcgtcgtcggc ctctcaatgtcctgtgagaaaatgttcgtgctccatcaacagaagaagtgcaaaaagtga

DBGET integrated database retrieval system