Clinocottus analis (woolly sculpin): 137784399 Help Entry 137784399         CDS       T10471                                  Name (RefSeq) CD59 glycoprotein-like   KO K04008   CD59 antigen Organism cana  Clinocottus analis (woolly sculpin) Brite KEGG Orthology (KO) [BR:cana00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cana04147]     137784399    04090 CD molecules [BR:cana04090]     137784399    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cana00537]     137784399 Exosome [BR:cana04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    137784399   Exosomal proteins of other body fluids (saliva and urine)    137784399   Exosomal proteins of colorectal cancer cells    137784399 CD molecules [BR:cana04090]  Proteins   137784399 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cana00537]  Antigens   137784399 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Motif Other DBs NCBI-GeneID:  137784399 NCBI-ProteinID:  XP_068431105 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MMRSRVLFCLAVSFAMFGFGLSLQCYSCPDGSSNSCDVKQECNQGEDSCLKLTSGEKTYT RCMRYEDCDFMTLAVRYSVADFDFDCCQSKLCNGQEKGFLQKLKDFLG NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgatgaggagccgtgtgttgttttgcctggctgtcagctttgccatgtttggatttggc ctctcgctgcagtgctactcctgccccgacggctcctccaacagctgtgacgtcaagcag gagtgtaaccagggcgaagacagctgcctcaaactcaccagtggtgagaagacctacacg agatgtatgaggtacgaagactgtgacttcatgactctggccgtcagatactccgtcgct gactttgactttgactgctgtcagtccaaactctgcaacggccaagaaaaaggttttctt cagaagttgaaggattttttgggttaa

DBGET integrated database retrieval system