Clinocottus analis (woolly sculpin): 137784583 Help Entry 137784583         CDS       T10471                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism cana  Clinocottus analis (woolly sculpin) Pathway cana04382   Cornified envelope formation cana05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cana00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     137784583  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     137784583  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cana04147]     137784583 Exosome [BR:cana04147]  Exosomal proteins   Exosomal proteins of microglial cells    137784583 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 MCM4_WHD DAXX_hist_bd Cu-binding_MopE DUF826 MlaC Motif Other DBs NCBI-GeneID:  137784583 NCBI-ProteinID:  XP_068431467 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MPSELETAMESLINVFHRYAIKTGKDGFALTRRQLKELMENELCTFLQSQKDPAAVDKIM KDLDSNCDGHVDFEEFVSLVVGLSIACEHCYQNKMMQAKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggagaccgccatggagtccctcatcaacgtgttccaccgctacgcc attaagaccggcaaagatggcttcgctctcacccggcgacagctcaaagagttgatggag aacgagctgtgtaccttcctccagtcccagaaggaccctgctgctgtggacaaaatcatg aaggatctggacagcaactgtgacggccacgttgactttgaggagtttgtttccctggtt gttggactttccattgcctgtgagcattgctatcagaacaaaatgatgcaggcgaagaag taa

DBGET integrated database retrieval system