Clinocottus analis (woolly sculpin): 137796769 Help Entry 137796769         CDS       T10471                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism cana  Clinocottus analis (woolly sculpin) Pathway cana04137   Mitophagy - animal cana04140   Autophagy - animal cana04144   Endocytosis cana04145   Phagosome cana04148   Efferocytosis cana05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cana00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     137796769 (rab7a)    04145 Phagosome     137796769 (rab7a)    04140 Autophagy - animal     137796769 (rab7a)    04137 Mitophagy - animal     137796769 (rab7a)    04148 Efferocytosis     137796769 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     137796769 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cana04131]     137796769 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cana04147]     137796769 (rab7a)    04031 GTP-binding proteins [BR:cana04031]     137796769 (rab7a) Membrane trafficking [BR:cana04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     137796769 (rab7a) Exosome [BR:cana04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    137796769 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    137796769 (rab7a)   Exosomal proteins of colorectal cancer cells    137796769 (rab7a)   Exosomal proteins of bladder cancer cells    137796769 (rab7a) GTP-binding proteins [BR:cana04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     137796769 (rab7a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  137796769 NCBI-ProteinID:  XP_068450983 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagtactactcaaagtcattatccttggagactctggagttggg aagacctcgttgatgaaccagtatgtgaataagaagttcagtaaccagtacaaagccaca ataggtgctgatttcctgacgaaagaggtcatggtggatgacagacttgtcacgatgcag atttgggacacagccggtcaggagaggttccagtccctaggcgtggcattctaccgtgga gcagactgctgcgtcctggtgtttgacgtgacagcacccaacaccttcaagactctcgac agctggagggacgagtttttgatccaggccagccctcgagacccagagaacttccccttt gtggtgttgggcaacaagatagacttagagaacagacaggtgacaaccaagcgagcacag gcttggtgtcaaagcaagaacaacatcccatatttcgaaacaagcgccaaggaggcgatc aatgtggagcaggccttccagactattgcacgcaacgccctcaaacaggagaccgaagtg gagttgtacaacgagttccccgagccgataaagctggacaggaacgagcgagccaagccg tcagcggagacctgcagctgctga

DBGET integrated database retrieval system