Clinocottus analis (woolly sculpin): 137796771 Help Entry 137796771         CDS       T10471                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism cana  Clinocottus analis (woolly sculpin) Pathway cana04137   Mitophagy - animal cana04140   Autophagy - animal cana04144   Endocytosis cana04145   Phagosome cana04148   Efferocytosis cana05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cana00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     137796771    04145 Phagosome     137796771    04140 Autophagy - animal     137796771    04137 Mitophagy - animal     137796771    04148 Efferocytosis     137796771  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     137796771  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cana04131]     137796771   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cana04147]     137796771    04031 GTP-binding proteins [BR:cana04031]     137796771 Membrane trafficking [BR:cana04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     137796771 Exosome [BR:cana04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    137796771   Exosomal proteins of other body fluids (saliva and urine)    137796771   Exosomal proteins of colorectal cancer cells    137796771   Exosomal proteins of bladder cancer cells    137796771 GTP-binding proteins [BR:cana04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     137796771 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  137796771 NCBI-ProteinID:  XP_068450985 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccaggaagaaagtgctgttgaaagtcatcatcctgggagattcaggtgttgga aagacctccctaatgaaccagtatgtgaacaagaagtttagtaaccagtacaaagctaca ataggagcagacttcttgaccaaggaagtgatggtggacgaccggctcgttacaatgcag atctgggacacagctggtcaggagaggttccagtctttgggtgtagctttctatcgggga gccgactgctgcgtgctggtgtttgatgtgaccgcacccaacaccttcaagacactcgac agctggagggatgagttcctgatccaggccagccctcgggaccctgagaacttccccttt gtggtgctcggcaacaagattgacttggagaacagacaggtaaccaccaaaagggctcag gcttggtgtcagagtaagaacaacatcccctactttgagactagcgccaaagaagccatc aatgtagaacaggcattccagacaattgcacgcaacgccctcaaacaagaaacagaggtg gagttgtataatgaattcccggagcccataaaactggataggaatgacagagctaaacct tcagcagaaagctgcagctgctga

DBGET integrated database retrieval system