KEGG   Colobus angolensis palliatus (Angola colobus): 105505634
Entry
105505634         CDS       T08744                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cang  Colobus angolensis palliatus (Angola colobus)
Pathway
cang01521  EGFR tyrosine kinase inhibitor resistance
cang01522  Endocrine resistance
cang01524  Platinum drug resistance
cang04010  MAPK signaling pathway
cang04012  ErbB signaling pathway
cang04014  Ras signaling pathway
cang04015  Rap1 signaling pathway
cang04022  cGMP-PKG signaling pathway
cang04024  cAMP signaling pathway
cang04062  Chemokine signaling pathway
cang04066  HIF-1 signaling pathway
cang04068  FoxO signaling pathway
cang04071  Sphingolipid signaling pathway
cang04072  Phospholipase D signaling pathway
cang04114  Oocyte meiosis
cang04140  Autophagy - animal
cang04148  Efferocytosis
cang04150  mTOR signaling pathway
cang04151  PI3K-Akt signaling pathway
cang04210  Apoptosis
cang04218  Cellular senescence
cang04261  Adrenergic signaling in cardiomyocytes
cang04270  Vascular smooth muscle contraction
cang04350  TGF-beta signaling pathway
cang04360  Axon guidance
cang04370  VEGF signaling pathway
cang04371  Apelin signaling pathway
cang04380  Osteoclast differentiation
cang04510  Focal adhesion
cang04517  IgSF CAM signaling
cang04520  Adherens junction
cang04540  Gap junction
cang04550  Signaling pathways regulating pluripotency of stem cells
cang04611  Platelet activation
cang04613  Neutrophil extracellular trap formation
cang04620  Toll-like receptor signaling pathway
cang04621  NOD-like receptor signaling pathway
cang04625  C-type lectin receptor signaling pathway
cang04650  Natural killer cell mediated cytotoxicity
cang04657  IL-17 signaling pathway
cang04658  Th1 and Th2 cell differentiation
cang04659  Th17 cell differentiation
cang04660  T cell receptor signaling pathway
cang04662  B cell receptor signaling pathway
cang04664  Fc epsilon RI signaling pathway
cang04666  Fc gamma R-mediated phagocytosis
cang04668  TNF signaling pathway
cang04713  Circadian entrainment
cang04720  Long-term potentiation
cang04722  Neurotrophin signaling pathway
cang04723  Retrograde endocannabinoid signaling
cang04724  Glutamatergic synapse
cang04725  Cholinergic synapse
cang04726  Serotonergic synapse
cang04730  Long-term depression
cang04810  Regulation of actin cytoskeleton
cang04910  Insulin signaling pathway
cang04912  GnRH signaling pathway
cang04914  Progesterone-mediated oocyte maturation
cang04915  Estrogen signaling pathway
cang04916  Melanogenesis
cang04917  Prolactin signaling pathway
cang04919  Thyroid hormone signaling pathway
cang04921  Oxytocin signaling pathway
cang04926  Relaxin signaling pathway
cang04928  Parathyroid hormone synthesis, secretion and action
cang04929  GnRH secretion
cang04930  Type II diabetes mellitus
cang04933  AGE-RAGE signaling pathway in diabetic complications
cang04934  Cushing syndrome
cang04935  Growth hormone synthesis, secretion and action
cang04960  Aldosterone-regulated sodium reabsorption
cang05010  Alzheimer disease
cang05020  Prion disease
cang05022  Pathways of neurodegeneration - multiple diseases
cang05034  Alcoholism
cang05132  Salmonella infection
cang05133  Pertussis
cang05135  Yersinia infection
cang05140  Leishmaniasis
cang05142  Chagas disease
cang05145  Toxoplasmosis
cang05152  Tuberculosis
cang05160  Hepatitis C
cang05161  Hepatitis B
cang05163  Human cytomegalovirus infection
cang05164  Influenza A
cang05165  Human papillomavirus infection
cang05166  Human T-cell leukemia virus 1 infection
cang05167  Kaposi sarcoma-associated herpesvirus infection
cang05170  Human immunodeficiency virus 1 infection
cang05171  Coronavirus disease - COVID-19
cang05200  Pathways in cancer
cang05203  Viral carcinogenesis
cang05205  Proteoglycans in cancer
cang05206  MicroRNAs in cancer
cang05207  Chemical carcinogenesis - receptor activation
cang05208  Chemical carcinogenesis - reactive oxygen species
cang05210  Colorectal cancer
cang05211  Renal cell carcinoma
cang05212  Pancreatic cancer
cang05213  Endometrial cancer
cang05214  Glioma
cang05215  Prostate cancer
cang05216  Thyroid cancer
cang05218  Melanoma
cang05219  Bladder cancer
cang05220  Chronic myeloid leukemia
cang05221  Acute myeloid leukemia
cang05223  Non-small cell lung cancer
cang05224  Breast cancer
cang05225  Hepatocellular carcinoma
cang05226  Gastric cancer
cang05230  Central carbon metabolism in cancer
cang05231  Choline metabolism in cancer
cang05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cang05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cang00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105505634 (MAPK3)
   04012 ErbB signaling pathway
    105505634 (MAPK3)
   04014 Ras signaling pathway
    105505634 (MAPK3)
   04015 Rap1 signaling pathway
    105505634 (MAPK3)
   04350 TGF-beta signaling pathway
    105505634 (MAPK3)
   04370 VEGF signaling pathway
    105505634 (MAPK3)
   04371 Apelin signaling pathway
    105505634 (MAPK3)
   04668 TNF signaling pathway
    105505634 (MAPK3)
   04066 HIF-1 signaling pathway
    105505634 (MAPK3)
   04068 FoxO signaling pathway
    105505634 (MAPK3)
   04072 Phospholipase D signaling pathway
    105505634 (MAPK3)
   04071 Sphingolipid signaling pathway
    105505634 (MAPK3)
   04024 cAMP signaling pathway
    105505634 (MAPK3)
   04022 cGMP-PKG signaling pathway
    105505634 (MAPK3)
   04151 PI3K-Akt signaling pathway
    105505634 (MAPK3)
   04150 mTOR signaling pathway
    105505634 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    105505634 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105505634 (MAPK3)
   04148 Efferocytosis
    105505634 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    105505634 (MAPK3)
   04210 Apoptosis
    105505634 (MAPK3)
   04218 Cellular senescence
    105505634 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105505634 (MAPK3)
   04520 Adherens junction
    105505634 (MAPK3)
   04540 Gap junction
    105505634 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    105505634 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105505634 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105505634 (MAPK3)
   04613 Neutrophil extracellular trap formation
    105505634 (MAPK3)
   04620 Toll-like receptor signaling pathway
    105505634 (MAPK3)
   04621 NOD-like receptor signaling pathway
    105505634 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    105505634 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    105505634 (MAPK3)
   04660 T cell receptor signaling pathway
    105505634 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    105505634 (MAPK3)
   04659 Th17 cell differentiation
    105505634 (MAPK3)
   04657 IL-17 signaling pathway
    105505634 (MAPK3)
   04662 B cell receptor signaling pathway
    105505634 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    105505634 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    105505634 (MAPK3)
   04062 Chemokine signaling pathway
    105505634 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105505634 (MAPK3)
   04929 GnRH secretion
    105505634 (MAPK3)
   04912 GnRH signaling pathway
    105505634 (MAPK3)
   04915 Estrogen signaling pathway
    105505634 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    105505634 (MAPK3)
   04917 Prolactin signaling pathway
    105505634 (MAPK3)
   04921 Oxytocin signaling pathway
    105505634 (MAPK3)
   04926 Relaxin signaling pathway
    105505634 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    105505634 (MAPK3)
   04919 Thyroid hormone signaling pathway
    105505634 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    105505634 (MAPK3)
   04916 Melanogenesis
    105505634 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105505634 (MAPK3)
   04270 Vascular smooth muscle contraction
    105505634 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105505634 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    105505634 (MAPK3)
   04725 Cholinergic synapse
    105505634 (MAPK3)
   04726 Serotonergic synapse
    105505634 (MAPK3)
   04720 Long-term potentiation
    105505634 (MAPK3)
   04730 Long-term depression
    105505634 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    105505634 (MAPK3)
   04722 Neurotrophin signaling pathway
    105505634 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    105505634 (MAPK3)
   04380 Osteoclast differentiation
    105505634 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105505634 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105505634 (MAPK3)
   05206 MicroRNAs in cancer
    105505634 (MAPK3)
   05205 Proteoglycans in cancer
    105505634 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    105505634 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    105505634 (MAPK3)
   05203 Viral carcinogenesis
    105505634 (MAPK3)
   05230 Central carbon metabolism in cancer
    105505634 (MAPK3)
   05231 Choline metabolism in cancer
    105505634 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105505634 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105505634 (MAPK3)
   05212 Pancreatic cancer
    105505634 (MAPK3)
   05225 Hepatocellular carcinoma
    105505634 (MAPK3)
   05226 Gastric cancer
    105505634 (MAPK3)
   05214 Glioma
    105505634 (MAPK3)
   05216 Thyroid cancer
    105505634 (MAPK3)
   05221 Acute myeloid leukemia
    105505634 (MAPK3)
   05220 Chronic myeloid leukemia
    105505634 (MAPK3)
   05218 Melanoma
    105505634 (MAPK3)
   05211 Renal cell carcinoma
    105505634 (MAPK3)
   05219 Bladder cancer
    105505634 (MAPK3)
   05215 Prostate cancer
    105505634 (MAPK3)
   05213 Endometrial cancer
    105505634 (MAPK3)
   05224 Breast cancer
    105505634 (MAPK3)
   05223 Non-small cell lung cancer
    105505634 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105505634 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    105505634 (MAPK3)
   05161 Hepatitis B
    105505634 (MAPK3)
   05160 Hepatitis C
    105505634 (MAPK3)
   05171 Coronavirus disease - COVID-19
    105505634 (MAPK3)
   05164 Influenza A
    105505634 (MAPK3)
   05163 Human cytomegalovirus infection
    105505634 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105505634 (MAPK3)
   05165 Human papillomavirus infection
    105505634 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105505634 (MAPK3)
   05135 Yersinia infection
    105505634 (MAPK3)
   05133 Pertussis
    105505634 (MAPK3)
   05152 Tuberculosis
    105505634 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105505634 (MAPK3)
   05140 Leishmaniasis
    105505634 (MAPK3)
   05142 Chagas disease
    105505634 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105505634 (MAPK3)
   05020 Prion disease
    105505634 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    105505634 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    105505634 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105505634 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105505634 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105505634 (MAPK3)
   04934 Cushing syndrome
    105505634 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105505634 (MAPK3)
   01524 Platinum drug resistance
    105505634 (MAPK3)
   01522 Endocrine resistance
    105505634 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cang01001]
    105505634 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cang03036]
    105505634 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cang04147]
    105505634 (MAPK3)
Enzymes [BR:cang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105505634 (MAPK3)
Protein kinases [BR:cang01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105505634 (MAPK3)
Chromosome and associated proteins [BR:cang03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     105505634 (MAPK3)
Exosome [BR:cang04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105505634 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 105505634
NCBI-ProteinID: XP_011788901
Ensembl: ENSCANG00000031183
LinkDB
Position
Unknown
AA seq 350 aa
MVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREI
QILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQ
ILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRW
YRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDL
NCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPY
LEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGALEAP
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggtgaaggggcagccgttcgacgtgggcccgcgctacacgcagctgcagtacatcggc
gagggcgcgtacggcatggtcagctcggcctatgaccacgtgcgcaagactcgcgtggcc
atcaagaagatcagccccttcgagcatcagacctactgccagcgcacgctccgggagatc
cagatcctgctgcgcttccgccatgagaatgtcatcggcatccgagacattctgcgggcg
tccaccctggaagccatgagggatgtctacattgtgcaggacctgatggagactgacctg
tacaagttgctgaaaagccagcaactgagcaatgaccacatctgctacttcctctaccag
atcctgcggggcctcaagtacatccactccgccaatgtgctccaccgggatctaaagccc
tccaacctgctcatcaacaccacctgcgaccttaagatttgcgatttcggcctggcccgg
attgccgatcctgagcatgaccacaccggcttcctgacggagtatgtggctacacgctgg
taccgggccccagagatcatgctgaactccaagggctataccaagtccatcgacatctgg
tctgtgggctgcattctggctgagatgctctctaaccggcccatcttccctggcaagcac
tacctggatcagctcaaccacattctgggcatcctgggctccccatcccaggaggacctg
aattgtatcatcaacatgaaggcccgaaactacctacagtctctgccctccaagaccaag
gtggcttgggccaagcttttccccaagtcagactccaaagcccttgacctgctggaccgg
atgttaacctttaaccccaataaacggatcacagtggaggaagcgctggctcacccctac
ctggagcagtactatgacccgacggatgagccagtggccgaggagcccttcaccttcgcc
atggagctggatgacctacctaaggagcggctgaaggagctcatcttccaggagacagca
cgcttccagcccggggcgctagaggccccctaa

DBGET integrated database retrieval system